Total number of results for Ecdysis triggering hormone are 7
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP01107 |
DPSPEPFNPNYNRFRQKIPRI
|
21 | Daphnia pulex | Ecdysis triggering hormone | Ecdysis-triggering hormone 1 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP01108 |
GEGIIAEYMNSESFPHEGSLSNFFLKASKAVPRL
|
34 | Daphnia pulex | Ecdysis triggering hormone | Ecdysis-triggering hormone 2 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP01109 |
DEPPAFFLKIAKNIPRI
|
17 | Nasonia vitripennis | Ecdysis triggering hormone | Ecdysis triggering hormone | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP01110 |
DETPGFFIKLSKSVPRI
|
17 | Aedes aegypti | Ecdysis triggering hormone | Ecdysis triggering hormone-1b | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01111 |
GDFENFFLKQSKSVPRI
|
17 | Aedes aegypti | Ecdysis triggering hormone | Ecdysis triggering hormone-2b | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01112 |
DDSSPGFFLKITKNVPRL
|
18 | Drosophila melanogaster | Ecdysis triggering hormone | Ecdysis triggering hormone 1 | 16441518#Wegener C, Reinl T, Jänsch L, Predel R#Direct mass spectrometric peptide profiling and fragmentation of larval peptide hormone release sites in Drosophila melanogaster reveals tagma-specific peptide expression and differential processing#J Neurochem 2006 Mar;96(5):1362-74 | |
| NP01113 |
GENFAIKNLKTIPRI
|
15 | Drosophila melanogaster | Ecdysis triggering hormone | Ecdysis-triggering hormone 2 | 16441518#Wegener C, Reinl T, Jänsch L, Predel R#Direct mass spectrometric peptide profiling and fragmentation of larval peptide hormone release sites in Drosophila melanogaster reveals tagma-specific peptide expression and differential processing#J Neurochem 2006 Mar;96(5):1362-74 |